SCOPe 2.08: Domain d5hy6a1: 5hy6 A:16-85

Lineage for d5hy6a1 (5hy6 A:16-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [314823] (1 PDB entry)

8. Domain d5hy6a1: 5hy6 A:16-85 [314824]
   Other proteins in same PDB: d5hy6a2
   automated match to d3hksa1

Details for d5hy6a1

PDB Entry: 5hy6, 2.19 Å

PDB Description: spodoptera frugiperda eukaryotic translation initiation factor eif5a

PDB Compounds: (A:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d5hy6a1:

Sequence; same for both SEQRES and ATOM records:

>d5hy6a1 b.34.5.0 (A:16-85) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
asatfpmqcsalrkngfvmlkgrpckivemstsktgkhghakvhlvgidifngkkyedic
psthnmdvph

Timeline for d5hy6a1:

• d5hy6a1 first appeared in SCOPe 2.06
  
• d5hy6a1 appears in SCOPe 2.07