SCOPe 2.08: Domain d5hq0a1: 5hq0 A:1-289

Lineage for d5hq0a1 (5hq0 A:1-289)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5hq0a1: 5hq0 A:1-289 [314811]
   Other proteins in same PDB: d5hq0a2, d5hq0c_
   automated match to d4fkla_
   complexed with lz9

Details for d5hq0a1

PDB Entry: 5hq0, 2.3 Å

PDB Description: ternary complex of human proteins cdk1, cyclin b and cks2, bound to an inhibitor

PDB Compounds: (A:) Cyclin-dependent kinase 1

SCOPe Domain Sequences for d5hq0a1:

Sequence; same for both SEQRES and ATOM records:

>d5hq0a1 d.144.1.7 (A:1-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh
pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch
srrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevllgsar
ystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdyknt
fpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfnd

Timeline for d5hq0a1:

• d5hq0a1 first appeared in SCOPe 2.06
  
• d5hq0a1 appears in SCOPe 2.07