Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
Domain d5hg1a2: 5hg1 A:223-465 [314787] automated match to d2nzta2 complexed with 62c, bg6, flc |
PDB Entry: 5hg1 (more details), 2.76 Å
SCOPe Domain Sequences for d5hg1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hg1a2 c.55.1.0 (A:223-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} nceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeid mgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdi egekdgirkarevlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkg eerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayr lad
Timeline for d5hg1a2: