Lineage for d5hkja3 (5hkj A:276-408)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2049110Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2049111Protein automated matches [190873] (4 species)
    not a true protein
  7. 2049112Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2049119Domain d5hkja3: 5hkj A:276-408 [314776]
    automated match to d2wnvb_
    complexed with ca, nag

Details for d5hkja3

PDB Entry: 5hkj (more details), 1.35 Å

PDB Description: single chain recombinant globular head of the complement system protein c1q
PDB Compounds: (A:) Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit C,Complement C1q subcomponent subunit B

SCOPe Domain Sequences for d5hkja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkja3 b.22.1.0 (A:276-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

SCOPe Domain Coordinates for d5hkja3:

Click to download the PDB-style file with coordinates for d5hkja3.
(The format of our PDB-style files is described here.)

Timeline for d5hkja3: