Lineage for d5hkja1 (5hkj A:2-136)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777605Domain d5hkja1: 5hkj A:2-136 [314774]
    automated match to d2wnvb_
    complexed with ca, nag

Details for d5hkja1

PDB Entry: 5hkj (more details), 1.35 Å

PDB Description: single chain recombinant globular head of the complement system protein c1q
PDB Compounds: (A:) Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit C,Complement C1q subcomponent subunit B

SCOPe Domain Sequences for d5hkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkja1 b.22.1.0 (A:2-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwe
iclsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgs
eadsvfsgflifpsa

SCOPe Domain Coordinates for d5hkja1:

Click to download the PDB-style file with coordinates for d5hkja1.
(The format of our PDB-style files is described here.)

Timeline for d5hkja1: