Lineage for d5hmta1 (5hmt A:13-248)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164124Species Pelagibacter ubique [TaxId:335992] [314766] (3 PDB entries)
  8. 2164125Domain d5hmta1: 5hmt A:13-248 [314767]
    Other proteins in same PDB: d5hmta2
    automated match to d3kbra_

Details for d5hmta1

PDB Entry: 5hmt (more details), 1.57 Å

PDB Description: crystal structure of the cyclohexadienyl dehydratase-like solute- binding protein sar11_1068 from candidatus pelagibacter ubique.
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5hmta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmta1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]}
eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl

SCOPe Domain Coordinates for d5hmta1:

Click to download the PDB-style file with coordinates for d5hmta1.
(The format of our PDB-style files is described here.)

Timeline for d5hmta1:

  • d5hmta1 appears in periodic updates to SCOPe 2.06 starting on 2016-04-15
  • d5hmta1 became obsolete in SCOPe 2.07

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmta2