![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Fibroblast growth factor receptor 1 [56158] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56159] (32 PDB entries) |
![]() | Domain d5flfc_: 5flf C: [314742] automated match to d4v04b_ complexed with act, cl, pge, so4; mutant |
PDB Entry: 5flf (more details), 2.58 Å
SCOPe Domain Sequences for d5flfc_:
Sequence, based on SEQRES records: (download)
>d5flfc_ d.144.1.7 (C:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg lardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypg vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
>d5flfc_ d.144.1.7 (C:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeeqlsskdl vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttng rlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmd kpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
Timeline for d5flfc_:
![]() Domains from other chains: (mouse over for more information) d5flfa_, d5flfb_, d5flfd_, d5flfe_ |