Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
Protein automated matches [190838] (19 species) not a true protein |
Species Burkholderia vietnamiensis [TaxId:269482] [314740] (1 PDB entry) |
Domain d5hl6b_: 5hl6 B: [314741] automated match to d3rfbb_ complexed with edo |
PDB Entry: 5hl6 (more details), 1.85 Å
SCOPe Domain Sequences for d5hl6b_:
Sequence, based on SEQRES records: (download)
>d5hl6b_ d.110.2.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} tlstdphaskaelyatlaeqarslvesepdlianaanfsalvyhsldrlnwagfyffdgt elvvgpfqgkpacvrialgkgvcgtaaqtrqtqvvrdvhafpghiacdaaseseivvplv aadgtligvwdvdspvaarfddedrsgmealcrvfvehawqkardra
>d5hl6b_ d.110.2.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} tlstdphaskaelyatlaeqarslvesepdlianaanfsalvyhsldrlnwagfyffdgt elvvgpfqgkpacvrialgkgvcgtaaqtrqtqvvrdviacdaaseseivvplvaadgtl igvwdvdspvaarfddedrsgmealcrvfvehawqkardra
Timeline for d5hl6b_: