Lineage for d5hl6b_ (5hl6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970261Species Burkholderia vietnamiensis [TaxId:269482] [314740] (1 PDB entry)
  8. 2970263Domain d5hl6b_: 5hl6 B: [314741]
    automated match to d3rfbb_
    complexed with edo

Details for d5hl6b_

PDB Entry: 5hl6 (more details), 1.85 Å

PDB Description: crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
PDB Compounds: (B:) Putative GAF sensor protein

SCOPe Domain Sequences for d5hl6b_:

Sequence, based on SEQRES records: (download)

>d5hl6b_ d.110.2.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
tlstdphaskaelyatlaeqarslvesepdlianaanfsalvyhsldrlnwagfyffdgt
elvvgpfqgkpacvrialgkgvcgtaaqtrqtqvvrdvhafpghiacdaaseseivvplv
aadgtligvwdvdspvaarfddedrsgmealcrvfvehawqkardra

Sequence, based on observed residues (ATOM records): (download)

>d5hl6b_ d.110.2.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
tlstdphaskaelyatlaeqarslvesepdlianaanfsalvyhsldrlnwagfyffdgt
elvvgpfqgkpacvrialgkgvcgtaaqtrqtqvvrdviacdaaseseivvplvaadgtl
igvwdvdspvaarfddedrsgmealcrvfvehawqkardra

SCOPe Domain Coordinates for d5hl6b_:

Click to download the PDB-style file with coordinates for d5hl6b_.
(The format of our PDB-style files is described here.)

Timeline for d5hl6b_: