SCOPe 2.08: Domain d5hfkb1: 5hfk B:1-85

Lineage for d5hfkb1 (5hfk B:1-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256896] (3 PDB entries)

8. Domain d5hfkb1: 5hfk B:1-85 [314692]
   Other proteins in same PDB: d5hfka2, d5hfkb2
   automated match to d3gx0a1
   complexed with gsh

Details for d5hfkb1

PDB Entry: 5hfk, 1.55 Å

PDB Description: crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione

PDB Compounds: (B:) Disulfide-bond oxidoreductase YfcG

SCOPe Domain Sequences for d5hfkb1:

Sequence; same for both SEQRES and ATOM records:

>d5hfkb1 c.47.1.0 (B:1-85) automated matches {Escherichia coli [TaxId: 83333]}
midlyfaptpnghkitlfleeagldyrlikvdlgkggqfrpefllispnnkipaivdhsp
adggeplslfesgaillylaektgl

Timeline for d5hfkb1:

• d5hfkb1 first appeared in SCOPe 2.06
  
• d5hfkb1 appears in SCOPe 2.07