Lineage for d5hcvc_ (5hcv C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013223Domain d5hcvc_: 5hcv C: [314689]
    automated match to d2a3ia_
    complexed with 60r, cl

Details for d5hcvc_

PDB Entry: 5hcv (more details), 2.5 Å

PDB Description: identification of spirooxindole and dibenzoxazepine motifs as potent mineralocorticoid receptor antagonists
PDB Compounds: (C:) Mineralocorticoid receptor

SCOPe Domain Sequences for d5hcvc_:

Sequence, based on SEQRES records: (download)

>d5hcvc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpled
qitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqisl
qfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnnsgqs
wqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnak
plyfh

Sequence, based on observed residues (ATOM records): (download)

>d5hcvc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvmvleniepeivyagypdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
iqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvswqrfyqltkllds
mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvnakplyfh

SCOPe Domain Coordinates for d5hcvc_:

Click to download the PDB-style file with coordinates for d5hcvc_.
(The format of our PDB-style files is described here.)

Timeline for d5hcvc_: