SCOPe 2.08: Domain d5hdjb_: 5hdj B:

Lineage for d5hdjb_ (5hdj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [314644] (1 PDB entry)

8. Domain d5hdjb_: 5hdj B: [314645]
   automated match to d1zcha1
   complexed with edo, fmn

Details for d5hdjb_

PDB Entry: 5hdj, 1.89 Å

PDB Description: structure of b. megaterium nfra1

PDB Compounds: (B:) NfrA1

SCOPe Domain Sequences for d5hdjb_:

Sequence; same for both SEQRES and ATOM records:

>d5hdjb_ d.90.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
mnsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkl
aqlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqn
atlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkh
vyheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkef
vekqgfnk

Timeline for d5hdjb_:

• d5hdjb_ first appeared in SCOPe 2.06
  
• d5hdjb_ appears in SCOPe 2.07