Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255708] (2 PDB entries) |
Domain d5fzoa1: 5fzo A:2157-2498 [314590] Other proteins in same PDB: d5fzoa2, d5fzob2 automated match to d4c8da_ complexed with cl, edo, mn |
PDB Entry: 5fzo (more details), 1.84 Å
SCOPe Domain Sequences for d5fzoa1:
Sequence, based on SEQRES records: (download)
>d5fzoa1 b.82.2.0 (A:2157-2498) automated matches {Human (Homo sapiens) [TaxId: 9606]} iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg dhqadllnckdsiisnanvkefwdgfeevskrqknksgetvvlklkdwpsgedfktmmpa ryedllkslplpeycnpegkfnlashlpgffvrpdlgprlcsaygvvaakdhdigttnlh ievsdvvnilvyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyag kdvdkireflqkiskeqglevlpehdpirdqswyvnkklrqrlleeygvrtctliqflgd aivlpagalhqvqnfhsciqvtedfvspehlvesfhltqelr
>d5fzoa1 b.82.2.0 (A:2157-2498) automated matches {Human (Homo sapiens) [TaxId: 9606]} iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg dhqadllnckdsiisnanvkefwdgfeevskrqketvvlklkdwpsgedfktmmparyed llkslplpeycnpegkfnlashlpgffvrpdlgprlcsaygvvaakdhdigttnlhievs dvvnilvyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyagkdvd kireflqkiskeqglevlpehdpirdqswyvnkklrqrlleeygvrtctliqflgdaivl pagalhqvqnfhsciqvtedfvspehlvesfhltqelr
Timeline for d5fzoa1: