SCOPe 2.06: Domain d5dkrb_: 5dkr B:

Lineage for d5dkrb_ (5dkr B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)

8. Domain d5dkrb_: 5dkr B: [314552]
   automated match to d1cfpa_
   complexed with 5cz, ca

Details for d5dkrb_

PDB Entry: 5dkr, 1.74 Å

PDB Description: crystal structure of calcium-loaded s100b bound to sbi29

PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d5dkrb_:

Sequence; same for both SEQRES and ATOM records:

>d5dkrb_ a.39.1.2 (B:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe

Timeline for d5dkrb_:

• d5dkrb_ is new in SCOPe 2.06-stable
  
• d5dkrb_ appears in SCOPe 2.07
  
• d5dkrb_ appears in the current release, SCOPe 2.08