Lineage for d5ezve2 (5ezv E:183-326)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187450Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2187451Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (10 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2187471Domain d5ezve2: 5ezv E:183-326 [314448]
    automated match to d2v8qe1
    complexed with c1v, c2z, stu

Details for d5ezve2

PDB Entry: 5ezv (more details), 2.99 Å

PDB Description: x-ray crystal structure of amp-activated protein kinase alpha-2/alpha- 1 rim chimaera (alpha-2(1-347)/alpha-1(349-401)/alpha-2(397-end) beta-1 gamma-1) co-crystallized with c2 (5-(5-hydroxyl-isoxazol-3- yl)-furan-2-phosphonic acid)
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d5ezve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezve2 d.37.1.1 (E:183-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvltg

SCOPe Domain Coordinates for d5ezve2:

Click to download the PDB-style file with coordinates for d5ezve2.
(The format of our PDB-style files is described here.)

Timeline for d5ezve2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ezve1