Lineage for d5fkjd_ (5fkj D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2899461Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2899847Protein automated matches [190065] (7 species)
    not a true protein
  7. 2899921Species Mouse (Mus musculus) [TaxId:10090] [187006] (56 PDB entries)
  8. 2900033Domain d5fkjd_: 5fkj D: [314404]
    automated match to d2xupa_
    complexed with cl, g0w, nag, so4

Details for d5fkjd_

PDB Entry: 5fkj (more details), 3.13 Å

PDB Description: crystal structure of mouse acetylcholinesterase in complex with c-547, an alkyl ammonium derivative of 6-methyl uracil
PDB Compounds: (D:) acetylcholinesterase

SCOPe Domain Sequences for d5fkjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkjd_ c.69.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkl

SCOPe Domain Coordinates for d5fkjd_:

Click to download the PDB-style file with coordinates for d5fkjd_.
(The format of our PDB-style files is described here.)

Timeline for d5fkjd_: