SCOP 1.59: Domain d1qdlb_: 1qdl B:

Lineage for d1qdlb_ (1qdl B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins)

6. Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [52324] (1 PDB entry)

8. Domain d1qdlb_: 1qdl B: [31437]
   Other proteins in same PDB: d1qdla_

Details for d1qdlb_

PDB Entry: 1qdl, 2.5 Å

PDB Description: the crystal structure of anthranilate synthase from sulfolobus solfataricus

SCOP Domain Sequences for d1qdlb_:

Sequence; same for both SEQRES and ATOM records:

>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus}
mdltliidnydsfvyniaqivgelgsypivirndeisikgieridpdrliispgpgtpek
redigvsldvikylgkrtpilgvclghqaigyafgakirrarkvfhgkisniilvnnspl
slyygiakefkatryhslvvdevhrplivdaisaedneimaihheeypiygvqfhpesvg
tslgykilynflnrv

Timeline for d1qdlb_:

• d1qdlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdlb_ appears in SCOP 1.57
  
• d1qdlb_ appears in SCOP 1.61
  
• d1qdlb_ appears in the current release, SCOPe 2.08