Lineage for d1jdbi2 (1jdb I:153-380)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579490Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 579501Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 579502Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
  8. 579517Domain d1jdbi2: 1jdb I:153-380 [31435]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1

Details for d1jdbi2

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbi2 c.23.16.1 (I:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1jdbi2:

Click to download the PDB-style file with coordinates for d1jdbi2.
(The format of our PDB-style files is described here.)

Timeline for d1jdbi2: