SCOPe 2.08: Domain d5fgdq1: 5fgd Q:1-234

Lineage for d5fgdq1 (5fgd Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5fgdq1: 5fgd Q:1-234 [314345]
   Other proteins in same PDB: d5fgda_, d5fgdc2, d5fgde_, d5fgdg_, d5fgdi_, d5fgdj_, d5fgdl_, d5fgdn_, d5fgdo_, d5fgdq2, d5fgds_, d5fgdu_, d5fgdw_, d5fgdx_, d5fgdz_
   automated match to d1rypd_
   complexed with 3bv, cl, mes, mg; mutant

Details for d5fgdq1

PDB Entry: 5fgd, 2.8 Å

PDB Description: yeast 20s proteasome beta5-h(-2)l-t1a double mutant in complex with carfilzomib

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5fgdq1:

Sequence; same for both SEQRES and ATOM records:

>d5fgdq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5fgdq1:

• d5fgdq1 first appeared in SCOPe 2.06, called d5fgdq_
  
• d5fgdq1 was called d5fgdq_ in SCOPe 2.07