SCOPe 2.07: Domain d5f7wd1: 5f7w D:3-114

Lineage for d5f7wd1 (5f7w D:3-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d5f7wd1: 5f7w D:3-114 [314331]
   Other proteins in same PDB: d5f7wc2, d5f7wd2
   automated match to d4ldeb_
   complexed with bgc, fuc, gal, gla, nag

Details for d5f7wd1

PDB Entry: 5f7w, 2.81 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain 17875 in complex with blood group b lewis b heptasaccharide

PDB Compounds: (D:) Nanobody Nb-ER19

SCOPe Domain Sequences for d5f7wd1:

Sequence; same for both SEQRES and ATOM records:

>d5f7wd1 b.1.1.1 (D:3-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs

Timeline for d5f7wd1:

• d5f7wd1 first appeared in SCOPe 2.06
  
• d5f7wd1 appears in the current release, SCOPe 2.08