Lineage for d1bxrf2 (1bxr F:153-380)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68686Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 68687Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins)
  6. 68698Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 68699Species Escherichia coli [TaxId:562] [52322] (7 PDB entries)
  8. 68722Domain d1bxrf2: 1bxr F:153-380 [31431]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1

Details for d1bxrf2

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrf2 c.23.16.1 (F:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1bxrf2:

Click to download the PDB-style file with coordinates for d1bxrf2.
(The format of our PDB-style files is described here.)

Timeline for d1bxrf2:

68722
d1bxrf2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1bxrf1