SCOPe 2.07: Domain d5eyra1: 5eyr A:22-94

Lineage for d5eyra1 (5eyr A:22-94)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)

8. Domain d5eyra1: 5eyr A:22-94 [314297]
   Other proteins in same PDB: d5eyra2
   automated match to d1t56a1
   complexed with 5t0

Details for d5eyra1

PDB Entry: 5eyr, 1.57 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 5 at 1.57a resolution

PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5eyra1:

Sequence; same for both SEQRES and ATOM records:

>d5eyra1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d5eyra1:

• d5eyra1 first appeared in SCOPe 2.06
  
• d5eyra1 appears in the current release, SCOPe 2.08