Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries) |
Domain d5eyra1: 5eyr A:22-94 [314297] Other proteins in same PDB: d5eyra2 automated match to d1t56a1 complexed with 5t0 |
PDB Entry: 5eyr (more details), 1.57 Å
SCOPe Domain Sequences for d5eyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eyra1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn qadmalqtlaenp
Timeline for d5eyra1: