SCOPe 2.08: Domain d5fgaq1: 5fga Q:1-234

Lineage for d5fgaq1 (5fga Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5fgaq1: 5fga Q:1-234 [314244]
   Other proteins in same PDB: d5fgaa_, d5fgac2, d5fgae_, d5fgag_, d5fgai_, d5fgaj_, d5fgak_, d5fgal_, d5fgan_, d5fgao_, d5fgaq2, d5fgas_, d5fgau_, d5fgaw_, d5fgax_, d5fgay_, d5fgaz_
   automated match to d1rypd_
   complexed with cl, mg; mutant

Details for d5fgaq1

PDB Entry: 5fga, 2.7 Å

PDB Description: yeast 20s proteasome beta5-k33a mutant (propeptide expressed in trans)

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5fgaq1:

Sequence; same for both SEQRES and ATOM records:

>d5fgaq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5fgaq1:

• d5fgaq1 first appeared in SCOPe 2.06, called d5fgaq_
  
• d5fgaq1 was called d5fgaq_ in SCOPe 2.07