Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d5cz9c_: 5cz9 C: [314207] Other proteins in same PDB: d5cz9a_, d5cz9e_, d5cz9g_, d5cz9i_, d5cz9j_, d5cz9k_, d5cz9l_, d5cz9n_, d5cz9o_, d5cz9s_, d5cz9u_, d5cz9w_, d5cz9x_, d5cz9y_, d5cz9z_ automated match to d1rypd_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 5cz9 (more details), 2.9 Å
SCOPe Domain Sequences for d5cz9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cz9c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5cz9c_: