SCOPe 2.08: Domain d5cz9c1: 5cz9 C:1-234

Lineage for d5cz9c1 (5cz9 C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5cz9c1: 5cz9 C:1-234 [314207]
   Other proteins in same PDB: d5cz9a_, d5cz9c2, d5cz9e_, d5cz9g_, d5cz9i_, d5cz9j_, d5cz9k_, d5cz9l_, d5cz9n_, d5cz9o_, d5cz9q2, d5cz9s_, d5cz9u_, d5cz9w_, d5cz9x_, d5cz9y_, d5cz9z_
   automated match to d1rypd_
   complexed with 3bv, cl, mes, mg; mutant

Details for d5cz9c1

PDB Entry: 5cz9, 2.9 Å

PDB Description: yeast 20s proteasome beta5-d17n mutant in complex with carfilzomib; propeptide expressed in trans

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5cz9c1:

Sequence; same for both SEQRES and ATOM records:

>d5cz9c1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5cz9c1:

• d5cz9c1 first appeared in SCOPe 2.06, called d5cz9c_
  
• d5cz9c1 was called d5cz9c_ in SCOPe 2.07