Lineage for d5d0zc1 (5d0z C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994807Domain d5d0zc1: 5d0z C:1-234 [314191]
    Other proteins in same PDB: d5d0za_, d5d0zc2, d5d0ze_, d5d0zg_, d5d0zi_, d5d0zj_, d5d0zk_, d5d0zl_, d5d0zn_, d5d0zo_, d5d0zq2, d5d0zs_, d5d0zu_, d5d0zw_, d5d0zx_, d5d0zy_, d5d0zz_
    automated match to d1rypd_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5d0zc1

PDB Entry: 5d0z (more details), 2.9 Å

PDB Description: yeast 20s proteasome beta5-t1s mutant in complex with carfilzomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5d0zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0zc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5d0zc1:

Click to download the PDB-style file with coordinates for d5d0zc1.
(The format of our PDB-style files is described here.)

Timeline for d5d0zc1: