Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5d0zc1: 5d0z C:1-234 [314191] Other proteins in same PDB: d5d0za_, d5d0zc2, d5d0ze_, d5d0zg_, d5d0zi_, d5d0zj_, d5d0zk_, d5d0zl_, d5d0zn_, d5d0zo_, d5d0zq2, d5d0zs_, d5d0zu_, d5d0zw_, d5d0zx_, d5d0zy_, d5d0zz_ automated match to d1rypd_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 5d0z (more details), 2.9 Å
SCOPe Domain Sequences for d5d0zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d0zc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d5d0zc1:
View in 3D Domains from other chains: (mouse over for more information) d5d0za_, d5d0zb_, d5d0zd_, d5d0ze_, d5d0zf_, d5d0zg_, d5d0zh_, d5d0zi_, d5d0zj_, d5d0zk_, d5d0zl_, d5d0zm_, d5d0zn_, d5d0zo_, d5d0zp_, d5d0zq1, d5d0zq2, d5d0zr_, d5d0zs_, d5d0zt_, d5d0zu_, d5d0zv_, d5d0zw_, d5d0zx_, d5d0zy_, d5d0zz_ |