Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Centrolobium tomentosum [TaxId:500182] [313810] (2 PDB entries) |
Domain d5eyxa_: 5eyx A: [314178] automated match to d3zvxb_ complexed with ca, mn, nag |
PDB Entry: 5eyx (more details), 2.25 Å
SCOPe Domain Sequences for d5eyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eyxa_ b.29.1.1 (A:) automated matches {Centrolobium tomentosum [TaxId: 500182]} dslsfsfinfdqdernviaqgdarisgnnilqltrtdsdgtpvrstvgrilysaqvrlwe kstnrvanfqsqfsfflesplsnpadgiaffiappdtaipsgsaggllglfspktaqnes anqvlavefdtfyaqnsntwdpnyphigidvnsiksaktvrwerregvtlnvlvtynpst ktldvvatypdgqryqisvvvdvttvlpewvrvgfsaasgeqfqthnleswsftstllyt
Timeline for d5eyxa_: