SCOPe 2.08: Domain d5eyxa_: 5eyx A:

Lineage for d5eyxa_ (5eyx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Centrolobium tomentosum [TaxId:500182] [313810] (2 PDB entries)

8. Domain d5eyxa_: 5eyx A: [314178]
   automated match to d3zvxb_
   complexed with ca, mn, nag

Details for d5eyxa_

PDB Entry: 5eyx, 2.25 Å

PDB Description: monoclinic form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome.

PDB Compounds: (A:) Centrolobium tomentosum lectin

SCOPe Domain Sequences for d5eyxa_:

Sequence; same for both SEQRES and ATOM records:

>d5eyxa_ b.29.1.1 (A:) automated matches {Centrolobium tomentosum [TaxId: 500182]}
dslsfsfinfdqdernviaqgdarisgnnilqltrtdsdgtpvrstvgrilysaqvrlwe
kstnrvanfqsqfsfflesplsnpadgiaffiappdtaipsgsaggllglfspktaqnes
anqvlavefdtfyaqnsntwdpnyphigidvnsiksaktvrwerregvtlnvlvtynpst
ktldvvatypdgqryqisvvvdvttvlpewvrvgfsaasgeqfqthnleswsftstllyt

Timeline for d5eyxa_:

• d5eyxa_ first appeared in SCOPe 2.06
  
• d5eyxa_ appears in SCOPe 2.07