Lineage for d1c30d2 (1c30 D:153-380)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22286Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 22287Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins)
  6. 22291Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 22292Species Escherichia coli [TaxId:562] [52322] (7 PDB entries)
  8. 22298Domain d1c30d2: 1c30 D:153-380 [31414]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1

Details for d1c30d2

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30d2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgislgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1c30d2:

Click to download the PDB-style file with coordinates for d1c30d2.
(The format of our PDB-style files is described here.)

Timeline for d1c30d2:

22298
d1c30d2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1c30d1