SCOPe 2.06: Domain d5f97f1: 5f97 F:3-114

Lineage for d5f97f1 (5f97 F:3-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5f97f1: 5f97 F:3-114 [314086]
   Other proteins in same PDB: d5f97e2, d5f97f2, d5f97g2, d5f97h2
   automated match to d4ldeb_
   complexed with a2g, bgc, fuc, gal, nag

Details for d5f97f1

PDB Entry: 5f97, 2.62 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group a type 1 hexasaccharide

PDB Compounds: (F:) Nanbody Nb-ER19

SCOPe Domain Sequences for d5f97f1:

Sequence; same for both SEQRES and ATOM records:

>d5f97f1 b.1.1.1 (F:3-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs

Timeline for d5f97f1:

• d5f97f1 is new in SCOPe 2.06-stable
  
• d5f97f1 appears in SCOPe 2.07
  
• d5f97f1 appears in the current release, SCOPe 2.08