Lineage for d5f93d1 (5f93 D:3-114)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (22 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) 
Domain d5f93d1: 5f93 D:3-114 [314080]
Other proteins in same PDB: d5f93c2, d5f93d2, d5f93f2, d5f93h2
automated match to d4ldeb_
complexed with fuc, gal, glc, nag
Details for d5f93d1
PDB Entry: 5f93 (more details), 2.99 Å
PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group h lewis b hexasaccharide
PDB Compounds: (D:) Nanobody Nb-ER19SCOPe Domain Sequences for d5f93d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f93d1 b.1.1.1 (D:3-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs
SCOPe Domain Coordinates for d5f93d1:
Click to download the PDB-style file with coordinates for d5f93d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5f93d1:
View in 3D
