Lineage for d1gpma2 (1gpm A:3-207)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311797Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures
  5. 311798Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (6 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 311872Protein GMP synthetase [52319] (1 species)
  7. 311873Species Escherichia coli [TaxId:562] [52320] (1 PDB entry)
  8. 311874Domain d1gpma2: 1gpm A:3-207 [31405]
    Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3

Details for d1gpma2

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

SCOP Domain Sequences for d1gpma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli}
enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
evthtrqgmrmlerfvrdicqceal

SCOP Domain Coordinates for d1gpma2:

Click to download the PDB-style file with coordinates for d1gpma2.
(The format of our PDB-style files is described here.)

Timeline for d1gpma2: