Lineage for d1hnwb_ (1hnw B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120785Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
  5. 120786Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 120787Protein Ribosomal protein S2 [52315] (1 species)
  7. 120788Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)
  8. 120792Domain d1hnwb_: 1hnw B: [31403]
    Other proteins in same PDB: d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwb_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1hnwb_:

Click to download the PDB-style file with coordinates for d1hnwb_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwb_: