SCOP 1.57: Domain d1hnzb_: 1hnz B:

Lineage for d1hnzb_ (1hnz B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (1 species)

7. Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)

8. Domain d1hnzb_: 1hnz B: [31402]
   Other proteins in same PDB: d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzb_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzb_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

Timeline for d1hnzb_:

• d1hnzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzb_ appears in SCOP 1.59
  
• d1hnzb_ appears in the current release, SCOPe 2.08