Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Dihydrodipicolinate synthase [51574] (13 species) |
Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries) |
Domain d5f1vd_: 5f1v D: [314016] automated match to d3lera_ complexed with 3vn, edo, gol, pge has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5f1v (more details), 2.2 Å
SCOPe Domain Sequences for d5f1vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f1vd_ c.1.10.1 (D:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]} niiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtci eiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyehy kaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahep rmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyni nkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d5f1vd_: