Lineage for d1hr0b_ (1hr0 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120785Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
  5. 120786Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 120787Protein Ribosomal protein S2 [52315] (1 species)
  7. 120788Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)
  8. 120790Domain d1hr0b_: 1hr0 B: [31401]
    Other proteins in same PDB: d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0b_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1hr0b_:

Click to download the PDB-style file with coordinates for d1hr0b_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0b_: