Lineage for d5f7id2 (5f7i D:127-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977399Species Leishmania donovani [TaxId:5661] [313997] (1 PDB entry)
  8. 2977407Domain d5f7id2: 5f7i D:127-256 [313999]
    Other proteins in same PDB: d5f7ia3, d5f7ib3, d5f7ic3, d5f7id3, d5f7ie3, d5f7if3
    automated match to d4cs5a2
    protein/DNA complex; complexed with tlv

Details for d5f7id2

PDB Entry: 5f7i (more details), 2.95 Å

PDB Description: crystal structure of the complex of proliferating cell nuclear antigen from leishmania donovani with tetrachloro-l-thyronine at 2.95 angstrom resolution
PDB Compounds: (D:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5f7id2:

Sequence, based on SEQRES records: (download)

>d5f7id2 d.131.1.0 (D:127-256) automated matches {Leishmania donovani [TaxId: 5661]}
gipemdyrstvtlnsaefakivrdmqvfgdtvtiaiskegvkfsssgdvgqgytflqaag
vsdrstkgvevtmeepitlsfalrfmgifakgstlservtlkfakdspcmveygidnvgy
lryylapkvd

Sequence, based on observed residues (ATOM records): (download)

>d5f7id2 d.131.1.0 (D:127-256) automated matches {Leishmania donovani [TaxId: 5661]}
gipemdyrstvtlnsaefakivrdmqvfgdtvtiaiskegvkfsssgdvgqgytflqaag
vsdrgvevtmeepitlsfalrfmgifakgstlservtlkfakdspcmveygidnvgylry
ylapkvd

SCOPe Domain Coordinates for d5f7id2:

Click to download the PDB-style file with coordinates for d5f7id2.
(The format of our PDB-style files is described here.)

Timeline for d5f7id2: