Lineage for d1fjfb_ (1fjf B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22276Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
  5. 22277Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 22278Protein Ribosomal protein S2 [52315] (1 species)
  7. 22279Species Thermus thermophilus [TaxId:274] [52316] (6 PDB entries)
  8. 22280Domain d1fjfb_: 1fjf B: [31399]
    Other proteins in same PDB: d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfb_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1fjfb_:

Click to download the PDB-style file with coordinates for d1fjfb_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfb_: