SCOPe 2.06: Domain d5d5mh1: 5d5m H:3-115

Lineage for d5d5mh1 (5d5m H:3-115)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5d5mh1: 5d5m H:3-115 [313907]
   Other proteins in same PDB: d5d5ma1, d5d5mb_, d5d5mc1, d5d5md1, d5d5md2, d5d5me2, d5d5mg2
   automated match to d3q5ya1
   complexed with 2lj, act, gol

Details for d5d5mh1

PDB Entry: 5d5m, 2.2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64 tcr

PDB Compounds: (H:) M33.64 TCR Beta Chain

SCOPe Domain Sequences for d5d5mh1:

Sequence; same for both SEQRES and ATOM records:

>d5d5mh1 b.1.1.0 (H:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevpd
gysvsrantddfpltlasavpsqtsvyfcasseaggntgelffgegsrltvle

Timeline for d5d5mh1:

• d5d5mh1 is new in SCOPe 2.06-stable
  
• d5d5mh1 appears in SCOPe 2.07
  
• d5d5mh1 appears in the current release, SCOPe 2.08