![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) ![]() |
![]() | Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) |
![]() | Protein Type II 3-dehydroquinate dehydratase [52306] (5 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries) |
![]() | Domain d1d0ih_: 1d0i H: [31390] |
PDB Entry: 1d0i (more details), 1.8 Å
SCOP Domain Sequences for d1d0ih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ih_ c.23.13.1 (H:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor} prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs yvsqradgvvagcgvqgyvfgveriaalagags
Timeline for d1d0ih_: