Lineage for d5f74a_ (5f74 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333757Species Mouse (Mus musculus) [TaxId:10090] [313882] (4 PDB entries)
  8. 2333758Domain d5f74a_: 5f74 A: [313883]
    automated match to d4dnkb_
    complexed with amp

Details for d5f74a_

PDB Entry: 5f74 (more details), 2.35 Å

PDB Description: crystal structure of chrebp:14-3-3 complex bound with amp
PDB Compounds: (A:) 14-3-3 protein beta/alpha

SCOPe Domain Sequences for d5f74a_:

Sequence, based on SEQRES records: (download)

>d5f74a_ a.118.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
rvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfyl
kmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyy
eilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d5f74a_ a.118.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
rvissieqktnekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfylkm
kgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d5f74a_:

Click to download the PDB-style file with coordinates for d5f74a_.
(The format of our PDB-style files is described here.)

Timeline for d5f74a_: