SCOPe 2.06: Domain d5f1lb_: 5f1l B:

Lineage for d5f1lb_ (5f1l B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d5f1lb_: 5f1l B: [313851]
   automated match to d3hmeb_
   complexed with 5u2

Details for d5f1lb_

PDB Entry: 5f1l, 2.3 Å

PDB Description: crystal structure of the bromodomain of brd9 in complex with compound 9.

PDB Compounds: (B:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d5f1lb_:

Sequence; same for both SEQRES and ATOM records:

>d5f1lb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
estpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyk
svtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d5f1lb_:

• d5f1lb_ is new in SCOPe 2.06-stable
  
• d5f1lb_ appears in SCOPe 2.07
  
• d5f1lb_ appears in the current release, SCOPe 2.08