SCOPe 2.08: Domain d5f25a_: 5f25 A:

Lineage for d5f25a_ (5f25 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5f25a_: 5f25 A: [313832]
   automated match to d3hmeb_
   complexed with 5tu

Details for d5f25a_

PDB Entry: 5f25, 1.68 Å

PDB Description: crystal structure of the brd9 bromodomain in complex with compound 4.

PDB Compounds: (A:) brd9

SCOPe Domain Sequences for d5f25a_:

Sequence; same for both SEQRES and ATOM records:

>d5f25a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d5f25a_:

• d5f25a_ first appeared in SCOPe 2.06
  
• d5f25a_ appears in SCOPe 2.07