Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
Species Vibrio cholerae [TaxId:127906] [313713] (1 PDB entry) |
Domain d5elde_: 5eld E: [313813] automated match to d1jr0d_ complexed with gal, gla, mes, na, peg, pge |
PDB Entry: 5eld (more details), 1.4 Å
SCOPe Domain Sequences for d5elde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elde_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 127906]} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5elde_:
View in 3D Domains from other chains: (mouse over for more information) d5elda_, d5eldb_, d5eldc_, d5eldd_ |