SCOPe 2.08: Domain d5eswb1: 5esw B:1-188

Lineage for d5eswb1 (5esw B:1-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [313792] (1 PDB entry)

8. Domain d5eswb1: 5esw B:1-188 [313800]
   Other proteins in same PDB: d5eswa2, d5eswb2
   automated match to d4lyyd_
   complexed with po4

Details for d5eswb1

PDB Entry: 5esw, 2.4 Å

PDB Description: crystal structure of apo hypoxanthine-guanine phosphoribosyltransferase from legionella pneumophila

PDB Compounds: (B:) Purine/pyrimidine phosphoribosyltransferase

SCOPe Domain Sequences for d5eswb1:

Sequence; same for both SEQRES and ATOM records:

>d5eswb1 c.61.1.0 (B:1-188) automated matches {Legionella pneumophila [TaxId: 272624]}
mtipdkikavyekstclytsneveaaldrmaikihetlqdknpviicvmvgglvplgnll
hrldfplevdyvhatryrgdltggdilwkvrpssnlagrtvlvvddildggitlaaiine
ikamgaaevysavlvdkyrkrvpnglqkadfvglqvedhyifgygmdyheylrnapgifi
vhpdheas

Timeline for d5eswb1:

• d5eswb1 first appeared in SCOPe 2.06
  
• d5eswb1 appears in SCOPe 2.07