Lineage for d5dvzb_ (5dvz B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 2480983Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 2480993Domain d5dvzb_: 5dvz B: [313796]
    automated match to d5dw0a_
    complexed with na, po4

Details for d5dvzb_

PDB Entry: 5dvz (more details), 1.69 Å

PDB Description: holo trpb from pyrococcus furiosus
PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5dvzb_:

Sequence, based on SEQRES records: (download)

>d5dvzb_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkv

Sequence, based on observed residues (ATOM records): (download)

>d5dvzb_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdgqikpthsiapgldyp
gvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsr
deiiivnlsgrgdkdldivlkv

SCOPe Domain Coordinates for d5dvzb_:

Click to download the PDB-style file with coordinates for d5dvzb_.
(The format of our PDB-style files is described here.)

Timeline for d5dvzb_: