Lineage for d5ee3b2 (5ee3 B:304-387)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2504244Superfamily d.15.10: TGS-like [81271] (3 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 2504268Family d.15.10.0: automated matches [227173] (1 protein)
    not a true family
  6. 2504269Protein automated matches [226888] (3 species)
    not a true protein
  7. 2504272Species Oryza sativa [TaxId:39947] [313621] (4 PDB entries)
  8. 2504278Domain d5ee3b2: 5ee3 B:304-387 [313782]
    Other proteins in same PDB: d5ee3a1, d5ee3b1
    automated match to d2ohfa2
    complexed with anp, cl, epe, mg, so4

Details for d5ee3b2

PDB Entry: 5ee3 (more details), 2.9 Å

PDB Description: complex structure of osychf1 with amp-pnp
PDB Compounds: (B:) Obg-like ATPase 1

SCOPe Domain Sequences for d5ee3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ee3b2 d.15.10.0 (B:304-387) automated matches {Oryza sativa [TaxId: 39947]}
liyfftagpdevkcwqirrqtkapqaagtihtdfergficaevmkfddlkelgsesavka
agkyrqegktyvvqdgdiiffkfn

SCOPe Domain Coordinates for d5ee3b2:

Click to download the PDB-style file with coordinates for d5ee3b2.
(The format of our PDB-style files is described here.)

Timeline for d5ee3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ee3b1