Lineage for d5elxa2 (5elx A:287-481)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129107Species Saccharomyces cerevisiae [TaxId:307796] [313764] (1 PDB entry)
  8. 2129109Domain d5elxa2: 5elx A:287-481 [313766]
    automated match to d3peya2
    complexed with bef, m2a, mg, no3

Details for d5elxa2

PDB Entry: 5elx (more details), 1.81 Å

PDB Description: s. cerevisiae dbp5 bound to rna and mant-adp bef3
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d5elxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elxa2 c.37.1.0 (A:287-481) automated matches {Saccharomyces cerevisiae [TaxId: 307796]}
pnantlelqtnevnvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvl
ygklkseghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnyd
lptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvpt
ddwdevekivkkvlk

SCOPe Domain Coordinates for d5elxa2:

Click to download the PDB-style file with coordinates for d5elxa2.
(The format of our PDB-style files is described here.)

Timeline for d5elxa2: