Lineage for d5dvob2 (5dvo B:340-445)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028025Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2028028Species Human (Homo sapiens) [TaxId:9606] [88590] (67 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2028104Domain d5dvob2: 5dvo B:340-445 [313721]
    Other proteins in same PDB: d5dvoa1, d5dvob1
    automated match to d1hzhh4
    complexed with so4

Details for d5dvob2

PDB Entry: 5dvo (more details), 2.5 Å

PDB Description: fc k392d/k409d homodimer
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5dvob2:

Sequence, based on SEQRES records: (download)

>d5dvob2 b.1.1.2 (B:340-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennydttppvld
sdgsfflysdltvdksrwqqgnvfscsvmhealhnhytqkslslsp

Sequence, based on observed residues (ATOM records): (download)

>d5dvob2 b.1.1.2 (B:340-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrknqvsltclvkgfypsdiavewesngqpennydttppvldsdgs
fflysdltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d5dvob2:

Click to download the PDB-style file with coordinates for d5dvob2.
(The format of our PDB-style files is described here.)

Timeline for d5dvob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dvob1