Lineage for d5ehza_ (5ehz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (6 species)
  7. 2474399Species Mouse (Mus musculus) [TaxId:10090] [53479] (36 PDB entries)
  8. 2474446Domain d5ehza_: 5ehz A: [313701]
    automated match to d1j07a_
    complexed with 5nz, nag, p6g

Details for d5ehza_

PDB Entry: 5ehz (more details), 2.5 Å

PDB Description: mache-syn tz2pa5 complex from an equimolar mixture of the syn/anti isomers
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5ehza_:

Sequence, based on SEQRES records: (download)

>d5ehza_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
sat

Sequence, based on observed residues (ATOM records): (download)

>d5ehza_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdg
dflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvri
gvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarv
yayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfar
tgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOPe Domain Coordinates for d5ehza_:

Click to download the PDB-style file with coordinates for d5ehza_.
(The format of our PDB-style files is described here.)

Timeline for d5ehza_: