Lineage for d5dssb_ (5dss B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 2385801Species Mucuna pruriens [TaxId:157652] [313698] (1 PDB entry)
  8. 2385802Domain d5dssb_: 5dss B: [313699]
    automated match to d3iira_

Details for d5dssb_

PDB Entry: 5dss (more details), 2.8 Å

PDB Description: mp-4 contributes to snake venom neutralization by mucuna pruriens seeds through stimulation of cross-reactive antibodies
PDB Compounds: (B:) mp-4

SCOPe Domain Sequences for d5dssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dssb_ b.42.4.0 (B:) automated matches {Mucuna pruriens [TaxId: 157652]}
kndaepvidtdgnpllhrgkyyimpsnwgppggglrlgktrnlncpvtvlqdyneaingl
pvkfnireilprtiftdtelnieftekpncaenrawslfkgddrghkarvgiggsnghpg
gemlrggfygeqhglrngtyklvfcrdgsstcldvgrygnregrrlglseagelgvgfek
agggn

SCOPe Domain Coordinates for d5dssb_:

Click to download the PDB-style file with coordinates for d5dssb_.
(The format of our PDB-style files is described here.)

Timeline for d5dssb_: