Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries) |
Domain d5egua_: 5egu A: [313658] Other proteins in same PDB: d5egud2 automated match to d4hbwa_ complexed with 5nq, edo |
PDB Entry: 5egu (more details), 2.21 Å
SCOPe Domain Sequences for d5egua_:
Sequence, based on SEQRES records: (download)
>d5egua_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lpte
>d5egua_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiiktpmd mgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkinelpt e
Timeline for d5egua_:
View in 3D Domains from other chains: (mouse over for more information) d5egub_, d5eguc_, d5egud1, d5egud2 |